Use scientific notation to find the product of 7.13 • 10^-3 and 40 (help please)

Answers

Answer 1

Answer:

2.852 • 10⁻⁵

Step-by-step explanation:

Solve for 40(7.13 • 10⁻³)

285.2 • 10⁻³ = 2.852 • 10⁻⁵


Related Questions

Helpppp i don’t get this




Find the length of the third side. If necessary, round to the nearest tenth. 8 16 it’s on a triangle

Answers

Answer:

13.9

Step-by-step explanation:

Let the missing side be x.

Use Pythagorean:

x² + 8² = 16²x² = 256 - 64x² = 192x = √192x = 13.9 (rounded to the nearest tenth)

Elijah currently owes a total of $1,649.70 on his revolving credit accounts. What is Elijah's debt-to-credit ratio if the total of his revolving credit limits is $6,345.00? Round the final answer to the nearest whole percent.

a
26%

b
38%

c
41%

d
50%

Answers

a. 26%

sorry if wrong...

Elijah's debt-to-credit ratio is calculated by dividing his total debt by his total credit limits. In this case, the ratio is $1,649.70 / $6,345.00 = 0.2609, or about 26%. The answer is therefore (a) 26%.

Identify the function that is exponential

Answers

Answer:

d. y=-3(0.5)^x

Step-by-step explanation:

since all other functions are ^ of a number, whereas the odd one out is d with an x as an exponent

therefore y = -3(0.5)^x is exponential

hope this helps:)

what is 1 half of 2 thirds

Answers

Answer: + 1/3 or 0.3333333
Explanation: first you multiply 1/2 and 2/3 which is 1.2/2.3 which =2/6 =1.2/3.2=1/3

A solid metal sphere with diameter 6cm needs to be covered with a protective
material which costs £0.25 per cm2.
How much will it cost to cover the sphere with the material?
Give your answer rounded to 2 DP.

Answers

Answer:

It will cost: £28.28

Step-by-step explanation:

Area of sphere = 4 x π x r2

Area of Circle = 4 x π x 3^2 = 113.097 (radius is half of diameter)

113.097 / 0.25 = 28.28

Solve the quadratic by factoring. 3x^{2}+7=-8x+3 3x 2 +7=−8x+3

Answers

The roots of the given quadratic equation are x = -2/3 and x = -2.

What is a quadratic equation?

A quadratic equation is a equation that is of the form -

y = f{x} = ax² + bx + c

Given is a quadratic equation as follows -

3x² + 7 = - 8x + 3

The given quadratic equations are -

3x² + 7 = - 8x + 3

3x² + 8x = 3 - 7

3x² + 8x + 4 = 0

(x + 2/3)(x + 2) = 0

(x + 2/3) = 0   and   (x + 2) = 0

x = -2/3   and   x = -2    

Therefore, the roots of the given quadratic equation are x = -2/3 and x = -2.

To solve more questions on quadratic equations, visit the link below -

brainly.com/question/22412845

#SPJ1

help anyone or somebody please o^o

Answers

it might be 27:) not sure tho

Answer:

27 degrees

Step-by-step explanation:

Sum of angles in a triangle is 180 degrees.

x + 40 + 113 = 180

x + 153 = 180

x = 180 - 153

x = 27 degrees

What does 8 mean in math?

Answers

The number 8 (eight) is represented by a number and numeral.

It is the natural number that follows seven and precedes nine. Given that it is an integer and a cardinal number, it can be counted. It is distinguished from imaginary numbers by being categorised as a real number.

Eight is a composite number, and its proper divisors are 1, 2, and 4. Eight can be written as 23, which when said aloud sounds like two cubed. It has a 7 aliquot total. All powers of two add up to an aliquot that is one less than their own.

To learn more about number here:

https://brainly.com/question/17429689

#SPJ4

What is the coefficient in the following expression

Answers

It is 5. It's simple just think of as the number in front of the alphabet.

Find the volume of each figure. Round to the nearest hundredth when necessary.

Answers

Where is the question???

Ason is organizing the silverware drawer. He has 8 spoons. There are twice as many forks as spoons. There are 34 as many knives as forks. How many knives does Jason have

Answers

The result of two Newton's technique iterations to approximation a function's zero using the provided starting guess is 1.5262!

What is a formula that is iterative?

Iteration describes carrying out a process repeatedly. To get a new value, start with an initial value and enter it into the iteration formula. To solve an equation using iteration, apply the new value for the subsequent substitution after that, and so on.

By Newton's Method, we have new guess of a zero of a function that are f(x), xn+1, and by using the previous guess, xn, like so-

xn+1 = xn - f(xn)/f'(xn)

and herethe case is [tex]f(x) = cos(x), and so f'(x) = -sin(x).[/tex]

Also, furthermore, [tex]cos(x)/(-sin(x)) = -cot(x).[/tex]

here, we have to simplify the formula to get a better guess for a zero to: xn+1 = xn + cot(xn)

[tex]x1 = 0.6, so x2 = 0.6 + cot(0.6) = 2.06170...\\And x3 = 2.06170... + cot(2.06170...) = 1.52615...\\Ans = 1.5262![/tex]

To know more about iterative formula visit:

brainly.com/question/29567951

#SPJ4

NEED ANSWER ASAP GIVING 15 PTS!!! TEST DUE IN 5 MINS!!!
Given the rule y=12x−4 complete the table below.

Answers

Answer:

(-4,-52)

(1/12,-3)

(1/3,0)

(0,-4)

(3,32)

Step-by-step explanation

i think thats right

which value in the set {5,6,7,8,9} is a solution of the equation 21 - f = 13? Show your work.

Answers

Answer:

f=8

Step-by-step explanation:

Other way is to rest 21 by 13 that will give you 8.

If it takes 10 hours to travel from North Carolina to Florida driving an
average speed of 60 mph, how long will it take to travel from North
Carolina to Florida driving an average speed of 70 mph?

Is it direct variation or indirect variation?

Answers

Answer:

8.5 hrs? direct variation

Step-by-step explanation:

60 per hour is 600 for 10 hours so 70 per hour to go 600 miles is 8.57142857143 in the calculator

600/60 =10

600/70 = 8.5

and its direct variation because on a graph 8.5 8.5 squares up for ever 1 square going over every time and the graph does curve but I haven't learned this stuff in years so I'm not 100% sure

HELP HELP HELP I NEED HELP ASAP
How Do I answer this question

Answers

Answer:

You say help is no more

Step-by-step explanation:

There is no question

need help asap!!!! will give brainliest!

Answers

Answer:

Y = 3 [tex]\sqrt{2}/2[/tex] And x = 3

Step-by-step explanation:

Because this is a 45 to 45 degree triangle, the 3 * (square root of 2 )/2 is y as well. Because this is a 45-45 triangle, x should be y (Square root of 2). Therefore, replacing y with 3 * (square root of 2 )/2 and multiply the square root of 2, the answer for x is 3. If I got something wrong please tell me, thanks.

The sum of an integer and seven times next consecutive odd integers -26 find the value of the lesser integer

Answers

Answer:

-5

Step-by-step explanation:

Let n = an integer

Let (n+2) = the next consecutive odd integer

n + 7( n + 2) = -26  Distribute the 7

n + 7n + 7(2) = -26

n + 7n + 14 = -26  Combine like terms

8n +14 = -26  Subtract 14 from both sides

8n + 14 - 14 = -26 -14

8n = -40  Divide both sides by 8

n = -5

The next consecutive odd integer would be -3

Consecutive just means the next number.

What is the axis of symmetry of the function f x =-( x 9 )( x 21?

Answers

The axis of symmetry of the function f(x) = -( x 9 )( x 21) is x = 15.

The axis of symmetry of a parabola is a line that divides the parabola into two exact mirror images. In this case, the parabola is defined by the quadratic function f(x) = -(x-9)(x-21). To find the axis of symmetry, we can take the average of the x-coordinates of the two solutions, which are 9 and 21. The average of 9 and 21 is 15, so the axis of symmetry is x = 15. This means that the parabola is symmetrical about the line x = 15, and the vertex of the parabola is located at the point (15,0).

Learn more about Parabola here:

https://brainly.com/question/28094027

#SPJ4

What is the slope of y = 4x + 7?

Answers

Answer:

slope = 4

Step-by-step explanation:

Given equation

y = 4x + 7

Comparing the given equation with y = mx + c

so

Slope (m)

= 4

Hope it will help :)❤

The slope would be 4 !

What is the perimeter?
Help plz...
And No links!! I repeat No links!!

Answers

12

The Pythagorean Theorem makes the unknown side equal to four therefore 4+3+5 equals 12 which is your perimeter

Answer:

b=4

perimeter=12

Step-by-step explanation:

frist find b by using pythagory theorm

the a+b+c=perimeter

i need help plz and thanks

Answers

Answer:

[tex]\pi{r}^{2} [/tex]

[tex]\pi {(13.5)}^{2} [/tex]

27 is the diameter so u divide it by 2 to get the radius which is 13.5

equals 572.56

the mean of six numbers is 12 five of the numbers are 11 7 21 14 and 9 calculate the six numbers

Answers

Answer:

sixth number is 10

Step-by-step explanation:

(11 + 7 + 21 + 14 + 9 + x) / 6 = 12

(62 + x) / 6 = 12

cross-multiply to get:

62 + x = 72

x = 10

Let f be a polynomial with integer coefficients, of degree n>1. What is the maximal number of consecutive integers belonging to the sequence f(1),f(2),f(3),...

Answers

The maximal number of consecutive integers by using the expression [tex]2*sqrt(n*|a|).[/tex]

Let f(x) = ax^n + bx^{n-1} + ... + z be a polynomial with integer coefficients and degree n>1. According to the theorem of Tchebychev, the maximal number of consecutive integers belonging to the sequence f(1),f(2),f(3),... is bounded by the expression 2*sqrt(n*|a|), where a is the coefficient of the highest degree term of f(x).

For example, let f(x) = 3x^3 + 4x^2 - 5. The coefficient of the highest degree term is 3, and the degree of the polynomial is 3. Therefore, the maximal number of consecutive integers belonging to the sequence f(1),f(2),f(3),... is 2*sqrt(3*|3|) = 6.

To calculate this maximal number, we can follow these steps:

Identify the degree of the polynomial, n.

Identify the coefficient of the highest degree term, a.

Calculate the maximal number of consecutive integers by using the expression 2*sqrt(n*|a|).

Learn more about consecutive integers here:

https://brainly.com/question/1767889

#SPJ4

Which expression can be used to determine the total weight of a box that by itself weighs 0. 3 kilogram and contains p plaques that weigh 3. 2 kilograms each?​

Answers

The expression is t = 0.3 + 3.2p, where t is the box's overall weight and p is the number of plaques it contains.

Let's review the data given to us to properly respond to the question:

Weight of a box by itself = 0.3 kg

Weight of a plaque = 3.2 kg

The expression can be used to determine the total weight of the box :

We shall use the following phrase to respond to the query:

Total weight of the box in kg = t

Number of plaques inside the box = p

Hence, the expression t = 0.3 + 3.2p

To learn more about expression here:

https://brainly.com/question/28980347

#SPJ4

guess what answer correcly its a classic ill give you brailynes

Answers

Answer:

Um.. Hello there. You haven't added any links to this post so we cannot see what the question was. Sorry to bother you!

How do you plot a graph step by step?

Answers

Plotting a graph step by step is mentioned below.

Define Graph.

In math, a graph can be defined as a pictorial representation or a diagram that represents data or values in an organized manner. The points on the graph often represent the relationship between two or more things.

What is Bar graph?

Using rectangular bars with heights or lengths proportionate to the values they represent, a bar chart or bar graph displays categorical data. Both a vertical and a horizontal bar plot are possible. A column chart is another name for a vertical bar graph.

There are a few steps to follow when plotting a graph:

Identify the variables in the problem and choose which one to plot on the x-axis and which one to plot on the y-axis.Determine the range of values for each variable. This will help you decide how big to make the scales on the x and y-axis.Choose a scale for each axis. The scale should be such that all the points in the problem can be plotted on the graph. A typical scale is to have equal intervals between each tick mark on the axis.Plot the points on the graph by locating their x-coordinate and y-coordinate on the x-axis and y-axis, respectively, and connecting them with a dot.Draw the x- and y-axes and label them with the appropriate units and ranges. Be sure to include a label on the graph itself so that it's clear what the graph represents.Plot any lines or curves that are also a part of the problem. This could be a line of best fit, a linear regression line, a polynomial function or any other lines or curves that the problem calls for.Once you finished with the line/curve, it is a good practice to give the graph a title and to label the axis with the units used.Lastly, review the graph and ensure that it is accurate and clearly presents the information from the problem.

To know more about graph visit:

https://brainly.com/question/17267403

#SPJ1

In 2010, the population of a city was 191,000. From 2010 to 2015, the population grew by 3.9%. From 2015 to 2020, it fell by 3.3%. To the nearest 100 people, what was the population in 2020?

Answers

Answer:

The population by 2020 is 191,900

Step-by-step explanation:

Given that;

population 2010 (population in 2010): 191000

the population grew from 2010 to 2015: by 3.9%

so, population by 2015 = [tex]191000(1 + \frac{3.9}{100})[/tex]

                                      = [tex]191000(1 + 0.039)[/tex]

                                      = [tex]191000(1.039)[/tex]

                                      = [tex]198449[/tex]

the population drop from 2015 to 2020: 3.3%

so, population by 2015 = [tex]198449(1 - \frac{3.3}{100})[/tex]

                                      = [tex]198449(1 - 0.033)[/tex]

                                      = [tex]198449(0.967)[/tex]

                                      = [tex]191,900.183[/tex]

What is the largest prime factor of 999?

Answers

Answer:

37

Hope this helps :)

Anna's hair has grown
2
3
of an inch in the 6 weeks since her last haircut. How fast does her hair grow?

Answers

Her hair grows 1/9th of an inch. Hope this helped you

Answer:

Her hair grows 1/9th of an inch. Hope this helped you

Step-by-step explanation:

Which ordered pair is not a solution to the inequality 2x+4y<9

Answers

Answer:

2x+4y,9

Step-by-step explanation:

Other Questions
What is body mass index and what is it used for ? Identify the infinitive phrase in the following sentence.The new student was the first one to volunteer for the newly formed photography club.Group of answer choicesphotography clubwas the firstnewly formedto volunteer How might confirmation bias affect our ability to judge the accuracy of information found online? what is a difference between mass and volume 87.5 - 23.4 *O 64.1O 110.9054.1 What is the theoretical probability that an even number will be rolled on a number cube? I dont understand and also any fake answers will be reported The US policy against the spread of communism was called The Truman Doctrine. True or False How could the matter in a piece of rock at the top of a mountain eventually be incorporated into volcanic lava? Write a short essay showing how the atmosphere, hydrosphere, cryosphere, geosphere, and biosphere are involved in this process. Put the continuum of force in order from least to greatest force: A. Verbal Officer + Presence + Lethal + Empty Hand + Less LethalB. Less Lethal + Empty Hand + Lethal + Verbal + Officer PresenceC. Officer Presence + Verbal + Empty Hand + Less Lethal + Lethal what is 9.5 is what % of 50 i have a test tomorrow 1/11/23 and I dont understand it PPPLSSSSSS HELPPPPPP ILL GIVE BRAINLYEST Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom The lesson of the story is Never giveup!" What else might the author add tothe lesson of the story? Find the lope-intercept equation of the line that pae through (1,-3) and ha a lope of -1/4 What is the main idea of Geographical Landforms ? Can someone please help I need the answers please!!!!!!!!!!!! What are the 4 main purposes of text? The majority of thread Meister customers live outside of cities in colder climates Write a procedure ConvertToBinary that takes an input as a number from 0 to 16 (including 0 but not 16) and converts it to a binary number. The binary number should be returned as a list. A ________________ helps you "see" the previous frame and helps keep the movement of the video consistent. overlay appframes per secondhaunted framesonion skinghost skin Steam Workshop Downloader