Combine terms: 12a + 26b -4b – 16a.​

Answers

Answer 1

Answer:

The answer is -4a + 22b

Step-by-step explanation:

12a + 26b -4b -16a

12a - 16a + 26b - 4b

-4a + 22b

Thus, The answer is -4a + 22b

-TheUnknownScientist

Answer 2

Step-by-step explanation:

[tex] \mathfrak{SOLUTION} _{(By\:Mister360)} \begin{cases} \\ \rm \mapsto \: 12a + 26b - 4b - 16a \\ \\ \rm \mapsto \: 12a - 16a + 26b - 4b \\ \\ \rm \mapsto \: (12 - 16)a + (26 - 4)b \\ \\ \rm \mapsto \: - 4a + 22b \\ \\ \rm \mapsto \: - (4a - 22b) \end{cases}[/tex]


Related Questions

Find the measure of angle B. Round your answer to the nearest whole 10 points number. *​

Answers

Answer:

38

Step-by-step explanation:

180 - 104 = 76

76 divided by 2 = 38

Simplify (-8-r)+(2r-4) Plato question

Answers

Answer:

−12r+32−2r 2

Step-by-step explanation:

(−8−r)(2r−4)

Apply the distributive property by multiplying each term of −8−r by each term of 2r−4.

−16r+32−2r

2

+4r

Combine −16r and 4r to get −12r.

Answer:

R-12

Step-by-step explanation:

Open the parenthesis, then solve

-8-r + 2r-4

-r+2r-8-4

r-12

Your answer will be R-12

Please help
Match the items.
a. Multiplicative Inverse
b. Additive Inverse
c. Commutative Property of Multiplication
d. Distributive Property
e. Additive Identity Property
f. Associative Property of Addition

1. 5.6=6-5
2. -8+0= -8
3. (3+5) +9=3+ (5+9)
4. 5.1=1
5. 7+(-7)=0
6. 5(x−4)=5x−20

Answers

The matching of the items as follows ,a - 4 , b - 5, c - 1 , d - 6 ,  e - 2 , f - 3

What is a number ?

number is used to represent the quantity of number  and it is even used for calculations.  

a) Multiplicative inverse

if the product the given number and reciprocal of the given number is 1.

so,

5 * 1/5  = 1

as LHS = 5 * 1/5  = 1

RHS = 1

Hence , a - 4

b )  Additive inverse

if the summation of the given number and opposite sign of given number results 0 .

7 + (-7) = 0

LHS = 7+ (-7) = 0

RHS = 0

hence , b - 5

c ) Commutative Property of Multiplication

if a.b = b.a hence it is in Commutative Property of Multiplication .

so,  5.6 = 6.5

hence , c - 1

d) Distributive property

if a ( b + c ) = a*b + a*c than it is in distributive property .

hence , d - 6

e) Additive Identity Property

if a+ 0 = a hence it is Additive Identity Property

so , b - 2

f ) Associative Property of Addition

if (a+b) + c = a + (b+c ) hence it is in Associative Property of Addition

so , f - 3.

To learn more about number from the given link .

https://brainly.com/question/17429689

#SPJ1

Yesterday, the price of a gallon of gas at five gas stations was $3.56, $3.71,
$3.62, $3.93, and $3.83, respectively, but today each gas station raised it:
price by $0.08. What is today's mean price of a gallon of gas at the five
stations?
O A. $3.81
O B. $3.65
O C. $3.89
O D. $3.73

Answers

Answer:

c

Step-by-step explanation:

The mean price of a gallon of gas at the five stations is $3.81. Therefore, option A is the correct answer.

What is mean?

In statistics, the mean refers to the average of a set of values. The mean can be computed in a number of ways, including the simple arithmetic mean (add up the numbers and divide the total by the number of observations).

Given that, Yesterday, the price of a gallon of gas at five gas stations was $3.56, $3.71, $3.62, $3.93, and $3.83, respectively.

Today each gas station raised its price by $0.08

Now, mean =(3.56+3.71+3.62+3.93+3.83+5×0.08)/5

= (18.65+0.4)/5

= 19.05/5

= $3.81

Therefore, option A is the correct answer.

To learn more about an arithmetic mean visit:

https://brainly.com/question/15196910.

#SPJ2

Sarah completes 1/6 of a project in 1/4 of an hour. At this rate, how much of
the project does Sarah complete per hour? *

Answers

it should be 4/6 if i’m thinking simple

Explain what an exponential form is but leveled down for high schoolers

Answers

The required exponential function is given as y = aˣ where the value of a should be positive always.

What is an exponential function?

The function which is in format f(x) =aˣ where a is constant and x is variable,  the domain of this exponential function lies   (-∞, ∞).

here,
Since from the above definition exponential function is given as y = aˣ,
This shows the exponential increase and decrease, by means of exponential increase and decrease, a sudden in increase and sudden decrease of function as the value of a varies, see in the graph after the answer. And the value of an always remains positive.

Thus, the required exponential function is given as y = aˣ where the value of a should be positive always.

Learn more about exponential function here:

brainly.com/question/15352175

#SPJ1

4.
Calculate 30% of 500 kg​

Answers

Answer:

150 kg

Step-by-step explanation:

30% of 500 kg

[tex]=0.30*500[/tex]

[tex]=150[/tex]

150 kg

Aregular decagon has a radius of 8 cm. What is the approximate area of the decagon?​

Answers

Using a calculator we can approximate this to be A ≈ 568.89 cm^2.

What is regular decagon?

A regular decagon is a two-dimensional geometric shape with ten sides of equal length and ten interior angles of equal measure. It is a polygon, which is a two-dimensional shape made up of line segments (straight sides).

The approximate area of a regular decagon can be calculated using the formula A = (5/2) * a^2 * tan(π/5), where a is the length of each side. Since the radius of the decagon is 8 cm, the length of each side can be calculated using the formula a = 2r * sin(π/10) where r is the radius.

Plugging these values into the formula we get A = (5/2) * (2 * 8 * sin(π/10))^2 * tan(π/5) which simplifies to A = 320 * sin^2(π/10) * tan(π/5).
Using a calculator we can approximate this to be A ≈ 568.89 cm^2.


To learn more about regular decagon
https://brainly.com/question/19899848
#SPJ1

PLEASE HELP!!!!!!!!!!!

Answers

Answer:

the triangle is translated 2 units up, and is reflected across the x axis

Step-by-step explanation:

A soccer team has 15 players and needs to choose a captain and an assistant captain. How many ways can those positions be selected?

Answers

Answer:

91 ways. So the answer to the problem's question is THIS : in 15*91 = 1365 ways.

Step-by-step explanation:

need help!!!!!!!!!!!!

Answers

The answer to this question is D

4. What is the slope-intercept form of 9x + 3y = 15?
Oy=-3x+5
Oy=3x+5
Oy = 3x - 5
Oy=-3x - 5

Answers

The slope-intercept form of the equation 9x + 3y = 15 is y = -3x + 5.

What is slope-intercept form?

The line with m as the slope, m and c as the y-intercept is the graph of the linear equation y = mx + c. The values of m and c are real integers in the slope-intercept form of the linear equation.

The given equation is 9x + 3y = 15.

Rearranging it to get in slope-intercept form -

⇒ 9x + 3y = 15

⇒ 3y = -9x + 15

Dividing LHS and RHS by 3 -

⇒ y = -3x + 5

Here, the equation is the slope-intercept form y = mx + c.

So, the slope is m = -3 in the equation.

Therefore, the slope-intercept form is y = -3x + 5.

To learn more about slope-intercept form from the given link

https://brainly.com/question/1884491

#SPJ1

what would be themissing side length ​

Answers

The missing side length is 5.7.

What would be themissing side length?The missing side length AB, can be calculated using the Pythagorean Theorem.The Pythagorean Theorem states that in a right triangle, the sum of the squares of the lengths of the two sides adjacent to the right angle (A and B) is equal to the square of the length of the hypotenuse (C).In other words, AB^2 + BC^2 = AC^2.In this case, AB^2 = AC^2 - BC^2, or AB^2 = 6.7^2 - 3^2, which simplifies to AB^2 = 44.89.Taking the square root of both sides yields AB = 6.7.Therefore, the missing side length, AB, is 6.7.The missing side length of a triangle with sides of lengths a, b, and c is calculated by using the Pythagorean theorem, which states that a^2 + b^2 = c^2. In this case, we are given that side c is 3, and side a is 6.7.Using the Pythagorean theorem, we can solve for side b by rearranging the equation to read b^2 = c^2 - a^2. Plugging in our known values, we get b^2 = 9 - 44.89, or b^2 = -35.89.Since the square root of a negative number is not a real number, this implies that there is no real number solution for b, and therefore the missing side length of the triangle is not possible.

To learnmore about Pythagorean theorem refer to:

https://brainly.com/question/343682

#SPJ1

A bag contains 7 red cubes, 3 yellow cubes, 2 green cubes, and 4 blue cubes, one cube is selectef at random from the bag. What is the probability that the seleceted cube will not be blue.

Answers

The answer is 12/16 because there’s 4 blue cubes and 16 cubes total .

The probability that the selected cube will not be blue is given as;

P(selected cube not blue) = 3/4

We are given that;

Number of red cubes = 7 cubes

Number of yellow cubes = 3 cubes

Number of green cubes = 2 cubes

Number of blue cubes = 4 cubes

Total number of cubes = 7 + 3 + 2 + 4

Total number of cubes = 16 cubes

Probability that the cube that is selected is blue;

P(selected cube is blue) = 4/16 = 1/4

Thus, probability that it will not be blue will be;

P(selected cube not blue) = 1 - (1/4)

P(selected cube not blue) = 3/4

Read more at; https://brainly.com/question/9956655

-15 POINTS- Find the length of the indicated side of the similar figure X=[?]

Answers

X = 5

I found it by comparing the large triangle with the small triangle

4:12
1: 3

So i said if the sides are 1:3 , x:15 has to be 5:15

Hope it helps

Find the common difference of the arithmetic sequence − 19 , − 11 , − 3

Answers

Answer:

+ 8

Step-by-step explanation:

This is an arithmetic progression (AP) as there is a common difference between successive terms.

For example, looking at the first two terms,

Difference = 2nd term - 1st term

                  = -11 -(-19)

                  = -11 + 19

                  = +8

To check,

Looking at the second and third terms,

Difference = 3rd term - 2nd term

                  = -3 -(-11)

                  = -3 + 11

                  = +8

Hence, there is a common difference of +8 between consecutive terms, making it an AP.

Find the measure of line segment TU. Assume that lines which appear to be tangent to the circle are tangent.
A)
7
B)
8
0
9
D)
10

Answers

Answer:

d 10

Step-by-step explanation:

Answer:

Answer is D I’ve done it and got it right before

Step-by-step explanation:

PLEASE HELP!!


1. devin is making a candle by pouring melted wax into a mold in the shape of a square pyramid. each side of the base of the pyramid is 6 cm and the height of the pyramid is 9 cm. to get the wax for the candle, devin melts cubes of wax that are each 4 cm by 4 cm by 4 cm. how many of the wax cubes will devin need in order to make the candle? show your work.

Answers

Answer:

1.69

approximately 2 wax cubes

Step-by-step explanation:

number of wax cubes needed = volume of square pyramid / volume of cube

Volume of a pyramid = 1/3 x ( base area x height)

base area = length²

6² = 36

volume = 1/3 x (36 x 9) = 108

volume of a cube = length³

4³ = 64cm³

108/64 = 1.69

the students in Mr Marcos art class use six jars of paint for their project each student uses 2/3 jars of paint how many students were in Mr Marco's class​

Answers

The number of students that were in Mr Marco's class will be 9 students

How to illustrate the fraction?

A fraction simply means a piece of a whole. In this situation, the number is represented as a quotient such that the numerator and denominator are split. In this situation, in a simple fraction, the numerator as well as the denominator are both integers.

Here, the students in Mr Marcos art class use six jars of paint for their project each student uses 2/3 jars of paint

The number of students that were in Mr Marco's class will be:

= 6 ÷ 2/3

= 6 × 3/2

= 9 students

Learn more about fractions on:

brainly.com/question/78672

#SPJ1

A cylinder has a height of 9 inches. The radius of the cylinder is 1 3 1 3 the height of the cylinder. What is the approximate volume of the cylinder?

Answers

Answer:

254.57 in^3

Step-by-step explanation:

A cylinder has a height of 9 inches. The radius of the cylinder is 1 / 3 the height of the cylinder. What is the approximate volume of the cylinder?

volume of a cylinder = nr^2h

n = 22/7

r = radius

radius = 9 x 1/3 = 3 inches

(22/7) x (3^2) x 9 = 254.57 in^3

GIVING BRANLIEST ! NEED HELP! PLEASE
The probability that a birth will result in twins is 0.017. Assuming independence​ (perhaps not a valid​ assumption), what is the probability that out of 120 births in a​ hospital, there will be exactly 4 sets of​ twins?


The probability that there will be exactly 4 sets of twins is?

Answers

Answer:

0.0939 = 9.39% probability that there will be exactly 4 sets of twins.

Step-by-step explanation:

For each birth, there is only two possible outcomes. Either it results in twins, or it does not. The probability of a birth resulting in twins is independent of any other birth. This means that the binomial probability distribution is used to solve this question.

Binomial probability distribution

The binomial probability is the probability of exactly x successes on n repeated trials, and X can only have two outcomes.

[tex]P(X = x) = C_{n,x}.p^{x}.(1-p)^{n-x}[/tex]

In which [tex]C_{n,x}[/tex] is the number of different combinations of x objects from a set of n elements, given by the following formula.

[tex]C_{n,x} = \frac{n!}{x!(n-x)!}[/tex]

And p is the probability of X happening.

The probability that a birth will result in twins is 0.017.

This means that [tex]p = 0.017[/tex]

120 births:

This means that [tex]n = 120[/tex]

The probability that there will be exactly 4 sets of twins is?

This is P(X = 4).

[tex]P(X = x) = C_{n,x}.p^{x}.(1-p)^{n-x}[/tex]

[tex]P(X = 4) = C_{120,4}.(0.017)^{4}.(0.983)^{116} = 0.0939[/tex]

0.0939 = 9.39% probability that there will be exactly 4 sets of twins.

Use circle V to find the arc measure for arc PSU.

Answers

Answer:

arcPSU = 224degrees

Step-by-step explanation:

From the given diagram;

arcPSU = arcPQ + arcQR + arcRS + arcST + arcTU

Given

arcPQ = arcTU

arcQR = arcRS = 37

arcAST = 90

Since 136 + arcPQ + 37+37+90+arcTU = 360

136+2arcPQ+ 37+37+90= 360

2arcPQ+300 = 360

2arcPQ = 360 - 300

2arcPQ = 60

arcPQ = 60/2

arcPQ = 30degrees

Substitute into the above expression

arcPSU = arcPQ + arcQR + arcRS + arcST + arcTU

arcPSU = 360 - arcPU

arcPSU = 360 - 136

arcPSU = 224degrees

Write 31 5 as a mixed number.

Answers

Answer:

6 1/5

Step-by-step explanation:

Answer:

31/5 into a mixed number would be 6 1/5 .

A restaurant records the number of tables served each night, and the results have the values: minimum = 3, lower
quartile = 14, median = 23, upper quartile = 29, and maximum = 40.

Answers

Answer: A. The first one

Step-by-step explanation:

The first data can be represented in the box plot if the restaurant records the number of tables served each night, and option (A) is correct.

What is the box and whisker plot?

A box and whisker plot is a method of abstracting a set of data that is approximated using an interval scale. It's also known as a box plot. These are primarily used to interpret data.

We have data:

Minimum = 3

Lower = quartile = 14

Median = 23

Upper quartile = 29

Maximum = 40

From the above data, we can plot the data in the box plot.

Thus, the first data can be represented in the box plot if the restaurant records the number of tables served each night, and option (A) is correct.

Learn more about the box and whisker plot here:

brainly.com/question/3209282

#SPJ2

The law firm of Dewey, Cheetham, and Howe handled 18 personal injury cases this past year. This was 9/7 of the cases handled by the rival firm of Gypsum-Goode. How many personal injury cases were handled by Gypsum-Goode this year?

Answers

Answer:

14 cases

Step-by-step explanation:

Let x be the number of personal injury cases this year by Gypsum Goode

x* 9/7 = 18

Multiply each side by 7/9

x * 9/7 *7/9 = 18 * 7/9

x = 14

Nicholas performs an experiment in which he pulls a marble from a bag. In his experiment, he finds that he is twice as likely to pull a red marble as a blue marble. If Nicholas pulls 10 red marbles, how many blue marbles does he pull?

Answers

Answer:

5.

Step-by-step explanation:

Given that Nicholas performs an experiment in which he pulls a marble from a bag, and in his experiment, he finds that he is twice as likely to pull a red marble as a blue marble, to determine, if Nicholas pulls 10 red marbles, how many blue marbles does he pull, the following calculation must be performed:

10/2 = X

5 = X

Therefore, Nicholas pulls 5 blue marbles from the bag.

What is 2 plus 2 minus 4 plus 2​

Answers

Answer:

2

Step-by-step explanation:

2 + 2 - 4 + 2 = 2

Answer:

2

Step-by-step explanation:

2 + 2 = 4

4 - 4 = 0

0 + 2 = 2

Solve systems of equations by elimination -9x-2y=5 -9x-2y=11

Answers

Answer:

no solutions

Step-by-step explanation:

   -9x-2y=5

- (-9x-2y=11)

-9x-(-9x) - 2y-(-2y) = 5 - 11  ==> subtract the top two equations

-9x + 9x - 2y + 2y = -6  ==> subtracting by a negative number is equivalent

                                       to adding by a positive number

(-9x + 9x) - 2y + 2y = -6

0 - 2y + 2y = -6

0 - 0 = -6

0 [tex]\neq[/tex] -6  ==> Hence, there is no solutions.

It takes 7 hours for 12 men to paint a room.
How many men would be needed to paint the room in 3 hours?

Answers

24 men 4hr so I think 30 men

Answer: 28 men would be needed to paint the room

q=number of men for 3 hours

q x 1/84 x 3 = 1

q x 1/28 = 28

-4/3 x + (-1) =y what is the slope of this line?

Answers

Answer: y= -4 divided by 3 • x (-1)

Step-by-step explanation:

✨photo math✨

Other Questions
How might confirmation bias affect our ability to judge the accuracy of information found online? what is a difference between mass and volume 87.5 - 23.4 *O 64.1O 110.9054.1 What is the theoretical probability that an even number will be rolled on a number cube? I dont understand and also any fake answers will be reported The US policy against the spread of communism was called The Truman Doctrine. True or False How could the matter in a piece of rock at the top of a mountain eventually be incorporated into volcanic lava? Write a short essay showing how the atmosphere, hydrosphere, cryosphere, geosphere, and biosphere are involved in this process. Put the continuum of force in order from least to greatest force: A. Verbal Officer + Presence + Lethal + Empty Hand + Less LethalB. Less Lethal + Empty Hand + Lethal + Verbal + Officer PresenceC. Officer Presence + Verbal + Empty Hand + Less Lethal + Lethal what is 9.5 is what % of 50 i have a test tomorrow 1/11/23 and I dont understand it PPPLSSSSSS HELPPPPPP ILL GIVE BRAINLYEST Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom The lesson of the story is Never giveup!" What else might the author add tothe lesson of the story? Find the lope-intercept equation of the line that pae through (1,-3) and ha a lope of -1/4 What is the main idea of Geographical Landforms ? Can someone please help I need the answers please!!!!!!!!!!!! What are the 4 main purposes of text? The majority of thread Meister customers live outside of cities in colder climates Write a procedure ConvertToBinary that takes an input as a number from 0 to 16 (including 0 but not 16) and converts it to a binary number. The binary number should be returned as a list. A ________________ helps you "see" the previous frame and helps keep the movement of the video consistent. overlay appframes per secondhaunted framesonion skinghost skin Dan drank 7/8 of a bottle of water During basketball practice. He then drank Another 4/8 of a bottle after practice. How much water did he drink altogether thats The Night is a big black catThe Moon is her topaz eye,The stars are the mice she hunts at night,In the field of the sultry skyIdentify a metaphor from the poem Steam Workshop Downloader